high-proteindipsspreadshealthy-snacksrecipesmeal-prepvegan

10 Best High-Protein Dip & Spread Recipes 2026

Discover 10 high-protein dips and spreads with 8g+ protein per serving, perfect for snacking or meal prep.

By Olivia Carter, RDUpdated:

When it comes to snacking, high-protein dips and spreads are a fantastic way to boost your protein intake while enjoying delicious flavors. This curated list features recipes that contain at least 8 grams of protein per 60-gram serving, ensuring they are not only satisfying but also nutritious. Each recipe has been selected based on its protein content, calorie count, ingredient quality, and ease of preparation, making them perfect for any occasion.

Recipe NameCaloriesProteinCarbsFatPrep Time
Greek Yogurt Hummus608g7g2g10 mins
Cottage Cheese Ranch509g4g2g5 mins
White Bean Dip708g10g3g15 mins
Edamame Dip809g6g4g10 mins
Ricotta Spread908g5g6g5 mins
High-Protein Guacamole1009g8g7g10 mins
Spicy Chickpea Dip708g9g3g15 mins
Tofu Spinach Spread608g5g4g10 mins
Lentil Dip758g10g2g10 mins
Peanut Butter Yogurt Dip909g12g5g5 mins

How We Selected These Recipes

We focused on recipes that provide at least 8 grams of protein per 60-gram serving while maintaining a balanced macro profile. Each recipe was evaluated for its ingredient quality, preparation time, and overall flavor, ensuring they are practical for daily consumption and appealing to a variety of palates.

1. Greek Yogurt Hummus

This Greek Yogurt Hummus is a creamy and tangy alternative to traditional hummus, packed with protein and flavor. It stands out for its versatility and can be enjoyed with veggies, pita chips, or as a sandwich spread.

Ingredients

  • 120g Greek yogurt
  • 60g canned chickpeas, drained
  • 15g tahini
  • 10g lemon juice
  • 1g garlic powder
  • Salt to taste

Macros per serving

CaloriesProteinCarbsFat
608g7g2g

Quick prep

  1. In a blender or food processor, combine Greek yogurt, chickpeas, tahini, lemon juice, garlic powder, and salt.
  2. Blend until smooth and creamy, adjusting consistency with water if needed.
  3. Taste and adjust seasoning as desired.
  4. Serve immediately or refrigerate for later use.
  5. Enjoy with your favorite dippers!

Pro tip

Swap chickpeas for white beans for a different flavor profile while keeping the protein content high.

2. Cottage Cheese Ranch

This Cottage Cheese Ranch dip is a creamy and flavorful option that offers a healthy twist on traditional ranch dressing. It's perfect for dipping veggies or as a topping for salads.

Ingredients

  • 120g cottage cheese
  • 5g ranch seasoning mix
  • 10g lemon juice
  • Salt and pepper to taste

Macros per serving

CaloriesProteinCarbsFat
509g4g2g

Quick prep

  1. In a mixing bowl, combine cottage cheese, ranch seasoning, and lemon juice.
  2. Stir until well combined and creamy.
  3. Season with salt and pepper to taste.
  4. Serve immediately or chill in the refrigerator for 30 minutes.
  5. Pair with fresh veggies or whole-grain crackers.

Pro tip

Use low-fat cottage cheese for a lighter version without sacrificing protein.

3. White Bean Dip

This White Bean Dip is a smooth and creamy option that’s rich in protein and fiber. It’s perfect for entertaining or as a healthy snack.

Ingredients

  • 120g canned white beans, drained
  • 15g olive oil
  • 10g lemon juice
  • 1g garlic powder
  • Salt and pepper to taste

Macros per serving

CaloriesProteinCarbsFat
708g10g3g

Quick prep

  1. In a food processor, combine white beans, olive oil, lemon juice, and garlic powder.
  2. Blend until smooth and creamy.
  3. Season with salt and pepper to taste.
  4. Serve with pita chips or fresh veggies.
  5. Store leftovers in an airtight container in the refrigerator.

Pro tip

Add fresh herbs like rosemary or thyme for an extra flavor boost.

4. Edamame Dip

This Edamame Dip is a vibrant and protein-packed spread that’s both nutritious and delicious. It’s perfect for a light snack or as part of a healthy appetizer platter.

Ingredients

  • 120g shelled edamame (cooked)
  • 15g tahini
  • 10g lemon juice
  • 1g garlic powder
  • Salt to taste

Macros per serving

CaloriesProteinCarbsFat
809g6g4g

Quick prep

  1. In a food processor, combine cooked edamame, tahini, lemon juice, and garlic powder.
  2. Blend until smooth, adding water for desired consistency.
  3. Season with salt to taste.
  4. Serve with whole-grain crackers or veggie sticks.
  5. Store in an airtight container in the fridge for up to three days.

Pro tip

For a spicy kick, add a pinch of red pepper flakes or sriracha.

5. Ricotta Spread

This Ricotta Spread is a creamy and indulgent option that’s high in protein and perfect for spreading on toast or using in sandwiches. It’s easy to make and incredibly versatile.

Ingredients

  • 120g ricotta cheese
  • 10g honey or maple syrup
  • 5g lemon zest
  • Pinch of salt

Macros per serving

CaloriesProteinCarbsFat
908g5g6g

Quick prep

  1. In a bowl, combine ricotta cheese, honey, lemon zest, and salt.
  2. Stir until well combined and smooth.
  3. Adjust sweetness to taste.
  4. Spread on whole-grain toast or use as a filling for wraps.
  5. Enjoy immediately or refrigerate for later.

Pro tip

Mix in fresh herbs like basil or chives for a savory twist.

6. High-Protein Guacamole

This High-Protein Guacamole takes a classic favorite and boosts its protein content, making it a nutritious option for snacking or topping dishes. It’s creamy, flavorful, and easy to prepare.

Ingredients

  • 120g ripe avocado
  • 60g Greek yogurt
  • 10g lime juice
  • Salt and pepper to taste

Macros per serving

CaloriesProteinCarbsFat
1009g8g7g

Quick prep

  1. In a bowl, mash the avocado with a fork.
  2. Stir in Greek yogurt and lime juice until well combined.
  3. Season with salt and pepper to taste.
  4. Serve with tortilla chips or fresh veggies.
  5. Store in an airtight container, pressing plastic wrap directly onto the surface to minimize browning.

Pro tip

Add diced tomatoes or jalapeños for extra flavor and texture.

7. Spicy Chickpea Dip

This Spicy Chickpea Dip is a flavorful option that packs a protein punch while being easy to prepare. It’s perfect for serving at parties or as a healthy snack.

Ingredients

  • 120g canned chickpeas, drained
  • 15g tahini
  • 10g lemon juice
  • 1g cayenne pepper
  • Salt to taste

Macros per serving

CaloriesProteinCarbsFat
708g9g3g

Quick prep

  1. In a food processor, combine chickpeas, tahini, lemon juice, cayenne pepper, and salt.
  2. Blend until smooth and creamy.
  3. Adjust seasoning as needed.
  4. Serve with pita chips or fresh veggies.
  5. Store in the refrigerator for up to three days.

Pro tip

For a milder version, reduce the cayenne pepper or omit it altogether.

8. Tofu Spinach Spread

This Tofu Spinach Spread is a plant-based option that’s rich in protein and flavor. It’s great for spreading on sandwiches or as a dip for veggies.

Ingredients

  • 120g firm tofu
  • 60g fresh spinach
  • 10g lemon juice
  • 1g garlic powder
  • Salt to taste

Macros per serving

CaloriesProteinCarbsFat
608g5g4g

Quick prep

  1. In a blender, combine tofu, fresh spinach, lemon juice, garlic powder, and salt.
  2. Blend until smooth and creamy.
  3. Adjust seasoning as desired.
  4. Serve with whole-grain crackers or as a sandwich spread.
  5. Store in an airtight container in the refrigerator.

Pro tip

Add nutritional yeast for a cheesy flavor without the dairy.

9. Lentil Dip

This Lentil Dip is a hearty, protein-packed option that’s perfect for a filling snack or appetizer. It’s a great way to incorporate legumes into your diet.

Ingredients

  • 120g cooked lentils
  • 10g olive oil
  • 10g lemon juice
  • 1g cumin
  • Salt and pepper to taste

Macros per serving

CaloriesProteinCarbsFat
758g10g2g

Quick prep

  1. In a food processor, combine cooked lentils, olive oil, lemon juice, cumin, salt, and pepper.
  2. Blend until smooth.
  3. Taste and adjust seasoning as needed.
  4. Serve with whole-grain crackers or pita bread.
  5. Store leftovers in an airtight container in the fridge for up to three days.

Pro tip

Mix in chopped fresh herbs like cilantro or parsley for added freshness.

10. Peanut Butter Yogurt Dip

This Peanut Butter Yogurt Dip is a sweet and satisfying option that combines protein-rich yogurt with creamy peanut butter. It’s perfect for dipping fruits or as a spread.

Ingredients

  • 120g Greek yogurt
  • 30g peanut butter
  • 10g honey
  • 5g cocoa powder (optional)

Macros per serving

CaloriesProteinCarbsFat
909g12g5g

Quick prep

  1. In a bowl, mix Greek yogurt, peanut butter, honey, and cocoa powder until smooth.
  2. Taste and adjust sweetness as desired.
  3. Serve with apple slices or whole-grain crackers.
  4. Store in the refrigerator for up to three days.
  5. Enjoy as a healthy dessert or snack.

Pro tip

Use almond butter instead of peanut butter for a different flavor and added nutrients.

Bottom Line

These high-protein dips and spreads are not only nutritious but also versatile and easy to prepare. The top three recipes — Greek Yogurt Hummus, Cottage Cheese Ranch, and White Bean Dip — offer a great balance of protein, flavor, and convenience. Whether you're looking for a quick snack or a meal prep option, these recipes can be easily logged in calorie tracking apps like Nutrola, MyFitnessPal, or Cronometer for your dietary goals.

Frequently Asked Questions

What makes a dip or spread high-protein?

A dip or spread is considered high-protein if it contains at least 8 grams of protein per serving, achieved through ingredients like Greek yogurt, cottage cheese, or legumes.

How can I use these dips and spreads?

These dips and spreads can be used as snacks with vegetables or whole-grain crackers, as sandwich spreads, or as toppings for salads and bowls.

Are these recipes suitable for meal prep?

Yes, all these recipes can be made in advance and stored in the refrigerator for several days, making them convenient for meal prep.

Can I customize these recipes?

Absolutely! Feel free to adjust spices, herbs, or add other ingredients to suit your taste preferences.